High Purity Peptides | Fast Worldwide Shipping

LL-37 5mg

LL-37 5mg

LL-37 is the C-terminal fragment of human cathelicidin (hCAP18), a 37-residue cationic peptide studied for its role in innate immune signaling, antimicrobial activity, and wound-repair pathways. Supplied as a ≥98% HPLC-verified lyophilized powder for laboratory research use only.

+99% Purity Third-Party Tested COA Available

 39.99

30 in stock

In stock – Ships same day
SSL Secured
Secure Checkout
Guaranteed Delivery
Third-Party Tested

Certificate of Analysis

Third-Party Tested by Janoshik Analytical

Latest
99.539%
Purity
Variant
LL-37 5mg
Lot #
LL-2603
Labeled
LL-37 5 mg
Actual
N/A
Tested
Mar 16, 2026
View Certificate

Compound Information

Technical specifications


Molecular Profile

What Is LL-37?

TypeCationic Antimicrobial Peptide (Cathelicidin)
CAS Number154947-66-7
Molecular Weight4493.33 g/mol
SynonymsCathelicidin / hCAP18 (104–140) / CAMP
Amino Acids37 AA (Amphipathic α-helix)
SequenceLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
FormulaC205H340N60O53

Storage Requirements

Stability Information

Lyophilized powder; keep sealed, dry, and protected from light
Highly cationic — minimize contact with untreated glass surfaces
Aliquot after reconstitution; avoid repeated freeze–thaw cycles

Lyophilized Powder

-20°C preferred; 2–8°C for short-term handling

Reconstituted

2–8°C


About LL-37

LL-37 is the 37-residue C-terminal fragment of human cathelicidin (hCAP18), the only cathelicidin-derived antimicrobial peptide identified in humans. Its amphipathic α-helical structure and strong net positive charge allow it to associate with anionic microbial membranes, making it a widely used reference peptide in innate immunity research. Beyond direct antimicrobial activity, LL-37 is investigated for its immunomodulatory role — including chemotaxis, cytokine signaling, angiogenesis, and epithelial wound repair. Supplied as a high-purity lyophilized powder for reproducible in-vitro and approved in-vivo work. This product is for laboratory research and development purposes only and must be handled by qualified professionals. Not for human, therapeutic, or diagnostic use.


Research Highlights

Innate Immune Signaling

The only human cathelicidin peptide — a core reference compound for studying host-defense mechanisms at epithelial barriers.

Membrane Interaction Studies

Its cationic, amphipathic helix makes it a standard model for investigating peptide–lipid bilayer association and disruption.

Chemotaxis & Cytokine Response

Investigated for its immunomodulatory role in recruiting immune cells and shaping downstream inflammatory signaling.

Wound Repair & Angiogenesis

Studied for its influence on keratinocyte migration, re-epithelialization, and endothelial signaling in tissue-repair models.

Antimicrobial Reference Peptide

Frequently used as a benchmark control in comparative assays of novel antimicrobial peptide candidates.

≥98% HPLC Purity

Every batch is HPLC-verified and supplied lyophilized, ensuring reproducible results across long study timelines.

Product Specifications

Molecular Formula
C205H340N60O53
Molecular Weight
4493.33 g/mol
CAS Number
154947-66-7
Sequence
[LL-37, 37 aa]
Purity
≥98% (HPLC verified)
Form
Lyophilized powder
Appearance
White to off-white powder
Solubility
Soluble in water, bacteriostatic water
Storage
-20°C (lyophilized), 2–8°C (reconstituted)

Research Studies

Frequently Asked Questions

What is LL-37?

It is the 37-residue C-terminal fragment of human cathelicidin (hCAP18), the only cathelicidin-derived antimicrobial peptide found in humans.

Why is LL-37 studied in innate immunity research?

It combines direct membrane-active antimicrobial properties with immunomodulatory effects on chemotaxis, cytokine signaling, and tissue repair, making it a useful single-compound model for host-defense pathways.

How should LL-37 be reconstituted and handled?

Reconstitute with sterile or bacteriostatic water and aliquot before freezing. Because the peptide is highly cationic, use low-binding plasticware where possible and avoid repeated freeze–thaw cycles.

Is this product approved for human use?

No. This product has not been evaluated by the FDA and is strictly intended for research and development purposes by qualified professionals only.

LL-37 molecular structure

Summer Sale • 10% OFF Use Coupon SUMMER10

X